Protein Info for mRNA_878 in Rhodosporidium toruloides IFO0880

Name: 9246
Annotation: K14692 SLC30A5_7, ZNT5_7, MTP, MSC2 solute carrier family 30 (zinc transporter), member 5/7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 815 transmembrane" amino acids 36 to 53 (18 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 103 to 130 (28 residues), see Phobius details amino acids 155 to 171 (17 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details amino acids 417 to 438 (22 residues), see Phobius details amino acids 455 to 475 (21 residues), see Phobius details amino acids 488 to 505 (18 residues), see Phobius details amino acids 657 to 678 (22 residues), see Phobius details amino acids 689 to 707 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 388 to 810 (423 residues), 199.8 bits, see alignment E=2.9e-63 PF01545: Cation_efflux" amino acids 392 to 714 (323 residues), 125.4 bits, see alignment E=1.3e-40

Best Hits

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (815 amino acids)

>mRNA_878 K14692 SLC30A5_7, ZNT5_7, MTP, MSC2 solute carrier family 30 (zinc transporter), member 5/7 (Rhodosporidium toruloides IFO0880)
MSAGYVEAYDPRVSRRVSLSHISRIPRDASSLPSDLLFALLLSKGGVALALHASRDWLLA
QGYPAVRLTALVLFAAGGALMLWERPWTATKGGKRKTEPPNPVYPLLLFLDTLFALLSIS
RLSVLRFILLTSFAPLWARAPPFVKIAGRRAGERSNTFAITTAMVVLSYLADSTLSKTGS
ASRSGYLCVLAHLLAAGYRFELYAAHNGDEQQRSAMHANSTVAAAVGASVLAVLRAVFSS
SSKTSSAAPTDPFFPAPDSSSSLHLLVAAFLAITHLCIDPLLTRTLLTHIPPVRLLRPGW
PLTAVATAFIGYVGFGKAPSLSELAIGLIAWRAIRHIASTDPRSTVVPASGGVSTGTSSP
DQPFLTRLATFYRHLRATIKTILASPESRRIYFFLCLNLAFMFVQMAYGIWTNSLAIHMF
FDCLALAMGLFASVMATWPSNSVYTYGYSRVETLSGFANGIFLCLISIFIVFEAIQRLID
PPEMNTGQLLTVSAVGLAVNLVGMVATGGHHGHSHGGGGGHGHGHGHSHAPVRSNSTPFL
VKGGEDEHDDHHGHSHNGHSHSSHTATPARSSHNRSHSHASPAPSLSHLASPSPSHNRSH
SHSHSHAPSTPTSNGHSHDAHDGHGGHGEHGDCDSDDEDEGGAESAHAHDSHNMKGVFLH
VMADTLGSVGVIISTLLINRYGWTGFDPLASIFIAVMIFVSVIQLVVDSGRLLVLDMGEE
KEAEVRKALTALGRVEGVASFTKPRFWQKDPSSMVGSICIQLAPASGSAYDAHGRPTQFH
ASIDRVHARVRRVLRSHIAGLDDLTIQVEPTGGLG