Protein Info for mRNA_919 in Rhodosporidium toruloides IFO0880

Name: 9287
Annotation: KOG1397 Ca2+/H+ antiporter VCX1 and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 transmembrane" amino acids 172 to 192 (21 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 494 to 512 (19 residues), see Phobius details amino acids 532 to 554 (23 residues), see Phobius details amino acids 561 to 586 (26 residues), see Phobius details amino acids 598 to 615 (18 residues), see Phobius details amino acids 625 to 643 (19 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 198 to 359 (162 residues), 72.2 bits, see alignment E=2.5e-24 amino acids 498 to 639 (142 residues), 63.1 bits, see alignment E=1.6e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (651 amino acids)

>mRNA_919 KOG1397 Ca2+/H+ antiporter VCX1 and related proteins (Rhodosporidium toruloides IFO0880)
MVDPLTDVPDEPDDSGQSPAHPPFTAPSLDSHHATHASHAQLNPDQLRQRLLKSIAPATL
DSGDDATPHHAPTLRPTSSLPNLARGHAGGSESPAHLDDDVIEKVHRTNTQVNLVRPDIV
PSRRSTFFPPVHDTDADATAAAAPVPPPRPPLLAPKKPLGKNPTFRQCLLNVLRYSLLNA
LLVFVPVAWAMGLSHQSSTVTFVMSFFAIVPLAALLGFATEELALRVGDAFGGLLNATFG
NAVELIIAILALVKGELDVVRSSMLGSILSNCLLVAGGAFFVGGIRFYEQSYSLRAAQTN
INLLAIAVTAIVIPVGFHAFISAEGTQTEDLTDESVLRLSRGLAFILLAVYACYLIFQLY
THSWLYVPRPASSPRQPTTAAQLLLYADGPQPPTEGKVFRIPSLPSWGGSSSSSSEGSSS
GGSLRVRSRSVSGEQEEAEPTHAEEGSTRPPLSPTTLHPTTTSATHTNPNIDLEKQEHPA
EAVEVEHEEPKLSVWFALGLLVVVTGLTGVTAEFLVSSIDGLTATGNVSKEFVALILLPV
VGNAAEHVTALVVARKNKLDLSLAVAVGSSLQIALFVIPVLVLLAWCIGQPLDLEFDSFE
TLLVFLTVCVVNWAIADARTNWMEGAGLMFVYIIIATCVWFYPGSAPSSPA