Protein Info for mRNA_930 in Rhodosporidium toruloides IFO0880

Name: 9298
Annotation: K00861 RFK, FMN1 riboflavin kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01687: Flavokinase
  • amino acids 33 to 183 (151 residues), 109.6 bits, E=5.2e-36

Predicted SEED Role

"Riboflavin kinase (EC 2.7.1.26)" in subsystem Riboflavin, FMN and FAD metabolism (EC 2.7.1.26)

MetaCyc Pathways

• flavin salvage (2/2 steps found)
• flavin biosynthesis I (bacteria and plants) (6/9 steps found)
• flavin biosynthesis III (fungi) (6/9 steps found)
• 5,6-dimethylbenzimidazole biosynthesis I (aerobic) (1/3 steps found)
• flavin biosynthesis II (archaea) (4/10 steps found)
• roseoflavin biosynthesis (1/7 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (5/33 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.26

Protein Sequence (245 amino acids)

>mRNA_930 K00861 RFK, FMN1 riboflavin kinase (Rhodosporidium toruloides IFO0880)
MSSLVTRPKPIQHDPSVVRELIAGPHDGPQPPFPVYLDGWVTRGFGRGSKDLGCPTANLP
DSSIAPYAETLSTGVYFGFARVLDPNSATRSSTTSAFPTSSSSNDSKNEHDGVFPMVMSI
GWNPFYNNDTRTAEVHVLHTYPSDFYGKQLRVVMLGFIRPEYNYGSMDALIADINTDKLV
ALNSVSSPSPSPSSISTELTAAAPAVIPAKRGTNYARFAEDGFFWRESTLEPLPEGVDPE
KKREK