Protein Info for mRNA_956 in Rhodosporidium toruloides IFO0880

Name: 9324
Annotation: KOG2466 Uridine permease/thiamine transporter/allantoin transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 transmembrane" amino acids 75 to 94 (20 residues), see Phobius details amino acids 106 to 152 (47 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 388 to 411 (24 residues), see Phobius details amino acids 432 to 452 (21 residues), see Phobius details amino acids 470 to 490 (21 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 32 to 460 (429 residues), 290.5 bits, see alignment E=1.1e-90

Best Hits

KEGG orthology group: None (inferred from 38% identity to act:ACLA_098540)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (538 amino acids)

>mRNA_956 KOG2466 Uridine permease/thiamine transporter/allantoin transport (Rhodosporidium toruloides IFO0880)
METLRRIDRTIAVKQEAGSLGSSRWSNKDLDPVPANQRTWTAMDVASYWNSDQMAPATWD
LGSTMVGLGLCAREAIPLSFVAFFVIGIVLTLNGRIGATTHCSLPVVIRASFGIWGSYLA
ILVRAVLAILWLIILTYLRSMIVAVMTGAIWPSFLKIPNTLPPKLGIDTQTIIGFAILWV
FQAPLACVPVRRLAYFFKIKAWSSYILFGALFIWAMVVTKGKGFVLTGHFDEKLLPQGSR
SWAMIAGLNAVTGLYSTVSINIPDFSRFAKSPKASWAQLVAVPVFGCIPIAISICCAAAA
EQKYGQQVFDPASLCSLFDSRAARFFAGLGWFISTIGVNISANSVSFATDITSVMPRYLS
IFRCSVLAGILCWATNPWRIVTDAPQFYSFLSSYPVFLAPVATILATDFYIVRKGKVDVR
QFYDPEGIYRYFHGVNLRAVVAWIFALAPNLPAFAHAVDPTNPNPQPYTYYFSWYMSTFG
AFVWYLLFNYLFQPHSSFVEEAVYEVGTVEYTESTVASSAEKGEVDADKEYAAGVVAV