Protein Info for mRNA_981 in Rhodosporidium toruloides IFO0880

Name: 9349
Annotation: K11097 SNRPE, SME small nuclear ribonucleoprotein E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 PF01423: LSM" amino acids 32 to 90 (59 residues), 54 bits, see alignment E=5.7e-19

Best Hits

Swiss-Prot: 58% identical to RUXE_DROME: Probable small nuclear ribonucleoprotein E (SmE) from Drosophila melanogaster

KEGG orthology group: K11097, small nuclear ribonucleoprotein E (inferred from 64% identity to cci:CC1G_13677)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (96 amino acids)

>mRNA_981 K11097 SNRPE, SME small nuclear ribonucleoprotein E (Rhodosporidium toruloides IFO0880)
MASKSKTVLVQPINVIFKHLQQGTRVQLWLFDNLEQRLEGKILGFDEFMNVVLDDAEEVW
VKDTKTKKTGDRQQLGRLLLKGENITLISPVPSPRA