Protein Info for mRNA_996 in Rhodosporidium toruloides IFO0880

Name: 9364
Annotation: K19791 FET3_5 iron transport multicopper oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 569 to 590 (22 residues), see Phobius details PF07732: Cu-oxidase_3" amino acids 28 to 143 (116 residues), 119.1 bits, see alignment E=1.7e-38 PF00394: Cu-oxidase" amino acids 152 to 312 (161 residues), 128.3 bits, see alignment E=4.7e-41 PF07731: Cu-oxidase_2" amino acids 373 to 508 (136 residues), 115.8 bits, see alignment E=2e-37

Best Hits

KEGG orthology group: None (inferred from 47% identity to lbc:LACBIDRAFT_399752)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (633 amino acids)

>mRNA_996 K19791 FET3_5 iron transport multicopper oxidase (Rhodosporidium toruloides IFO0880)
MRIALSALAAAILAVPALADVVDAWYNISYTTAAPDGVDKPFTVGVNGTWPPPILNVKFN
DTVRVHAYNGLDAPTSIHHHGIFFNGTNYYDGAPGVTQCGLPPGQSLTYEVPVDRQHGTY
WWHSHTGAHYQDGLRAPFIIHATDEAHKYDGEYTIILSDWYHARSDKLNNKFMNKYNPTG
AEPVPDALLIYAASNGTYLPSNDDVKFNGNLSIPFEAGKTYRIRVLNAGIFATTFFWIDG
HDMRVIEADGVDTEEFPVDYLNIAVAQRYSVLVTARNDTSENFLVHANFDDGMFDSVPEG
LTLNYTTTISYKDGNPVAESEVRNELGRINDFEMVPFVPMEQLTPTTSLQLDVYFDAYST
GVNRASMLNNITYVNPKTPSLFTMMTMGNDSLNPNVYGPQTAQHLLNHGDVLDLMVINFD
ANAHPFHLHGFSYQLTRLAMDVTSDDPALNPPHTLGAKNPMRRDTIIIPAGGAVNLAVRA
DNPGAWIFHCHIQWHMEAGLAVVFMVDPLGAQQSMTIPQVMVDQCKQLGISPTGNAAGKM
SVTDLSGAPHGPVDQYAAGLFGWTPRAKGALAGCVLTALIGMLTVVWYAVGGQLDEDELQ
EEVHRDMEKKKAAGGGLLKRGFKAITGKSAAAQ