Protein Info for mRNA_1116 in Rhodosporidium toruloides IFO0880

Name: 9484
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 transmembrane" amino acids 100 to 123 (24 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 192 to 194 (3 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 393 to 417 (25 residues), see Phobius details amino acids 441 to 460 (20 residues), see Phobius details amino acids 466 to 490 (25 residues), see Phobius details amino acids 502 to 520 (19 residues), see Phobius details amino acids 531 to 552 (22 residues), see Phobius details PF07690: MFS_1" amino acids 106 to 513 (408 residues), 130.4 bits, see alignment E=8.2e-42 PF00083: Sugar_tr" amino acids 119 to 299 (181 residues), 48.5 bits, see alignment E=6.4e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (587 amino acids)

>mRNA_1116 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MPSSPFCTSPSPPSASDEVSAPPTAAAGDVLALQNEAASLSEQHPRVNDPAGDEADLETT
ASTVCDEADDGERDGGLALDVEHVPVNDDPRQWPRARKTAVLATIAFTAMGGTISASVFF
PALGSLQQELRANDPLVAASVSSFIAGQGVFPLLWSSLSEVTGRKKCYIVALVIYVVGSV
VCSRSNSIGVFIAMRVLQSLGSSAVLSLGAGTLADMYDTHERGEKLGVYYSVPLLGPALG
PIVGGAVTSASDWRAAFYFLVAYGGVCWLLALWLPDTFRHQRSLAWRKAYERAQQQAREK
RAKARSVLPKPASTSAFSPLKKIGTALSAKSGDVKVKIRFRDINPMAAAGAVLREPANVL
ILTYSGLIFGSQYCMTYTASRTFAAAPYNCTPIQVGLVLLAFGIGNVVGSVGGGRYSDYV
LRKMKERNGGKGEPEMRIKSTYPALAFLPPLFVAYAWTVYYKVHIAGPIVVLFFLGATLM
IIYASTLAYIVDANPGRSSSAVACNSLFRGALACAASQAAEPIMARVGHGAFYSGWGVLL
LLGEAALVIVAIKGKSWRAASQTRHEAEDERRRERREKRLHSLETQK