Protein Info for mRNA_1124 in Rhodosporidium toruloides IFO0880

Name: 9492
Annotation: K09613 COPS5, CSN5 COP9 signalosome complex subunit 5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01398: JAB
  • amino acids 49 to 160 (112 residues), 105.2 bits, E=2.2e-34
• PF18323: CSN5_C
  • amino acids 248 to 337 (90 residues), 86.2 bits, E=2.4e-28

Best Hits

KEGG orthology group: K09613, COP9 signalosome complex subunit 5 [EC: 3.4.-.-] (inferred from 56% identity to rcu:RCOM_0204710)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (363 amino acids)

>mRNA_1124 K09613 COPS5, CSN5 COP9 signalosome complex subunit 5 (Rhodosporidium toruloides IFO0880)
MAASSESVAQASFSLANNIQETDEVFKYDKQGQQDQLKARPWKQDPHHFKKVRISAVALI
KMVMHARSGGQYEIMGLMQGKLDGDTFVVMDAFALPVVGTETRVNAANEANEFMIQYIES
SPAIGRPENIVGWYHSHPGYGCWLSGIDVMTQKTNQQFQDPFLAVVIDPNRTISAGRVEI
GAFRTYPDGYTPPNASTSEYQSIPVDKIEDFGVHANSYYPLEVSHFKSTHDTKLLDLLWN
KYWVMTLSQSPLVSNRAYATTQLSDLVAKLRNTETSVSHRCNISHMSPLIVQIRQHLNSS
KEVTETPLARVVKDSSKMAGEASNGLIGALVKDALFSGGKLGQAGVVQATGEGGSLVLPP
VVS