Protein Info for mRNA_1165 in Rhodosporidium toruloides IFO0880

Name: 9533
Annotation: HMMPfam-Protein of unknown function (DUF1445)-PF07286,PIRSF--PIRSF029755,SUPERFAMILY--SSF160920

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07286: DUF1445
  • amino acids 115 to 262 (148 residues), 196 bits, E=1.5e-62

Best Hits

Swiss-Prot: 52% identical to Y2764_PSEU5: Putative hydro-lyase PST_2764 (PST_2764) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: None (inferred from 54% identity to cnb:CNBE5300)

Predicted SEED Role

"hypothetical protein possibly connected to lactam utilization and allophanate hydrolase"

Protein Sequence (270 amino acids)

>mRNA_1165 HMMPfam-Protein of unknown function (DUF1445)-PF07286,PIRSF--PIRSF029755,SUPERFAMILY--SSF160920 (Rhodosporidium toruloides IFO0880)
MTVAATALSPYDVRLACRNGTWKEASTAGVCEGYVQANLIILPERHAADFRALCARNPVP
CPLLGETKPGDPTIPSHLANDCDIRTDAPRYNVYRNGKFVETKRDIKDEWKEDSVGFLVG
CSFSFEAALVKGGYMPRQIEIKRNVPMYKTKVPLCAAGALTGNMVVSMRPYPPSAIETVR
DLTRPFIRAHGEPVAWGSEGAAALGIDDPTGANPDFGEASEVREGEVPVYWACGVTPQSV
VMASKIEGVVLGHAPGHMLVLDMRDEDVCK