Protein Info for mRNA_1192 in Rhodosporidium toruloides IFO0880

Name: 9560
Annotation: KOG2504 Monocarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 81 to 103 (23 residues), see Phobius details amino acids 115 to 139 (25 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details amino acids 449 to 472 (24 residues), see Phobius details PF07690: MFS_1" amino acids 83 to 393 (311 residues), 39.8 bits, see alignment E=1.4e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>mRNA_1192 KOG2504 Monocarboxylate transporter (Rhodosporidium toruloides IFO0880)
MATSTIVSSTLPPPPLPTDEDSRGGISPSPTVQTAADPSQPDSGPVTPSRISTFDFGDGE
DSAKALAPVDGGRHAWQFLAASFLLEIFVWGYAFSFATILVYLQSHDPWQRNSLSALSAI
GTTQLGLLYVLPTFAVVVLRRYGEYVRLVQWTSLVVSCTSMFLSSWATQLWQLVVLQGFL
CGVANTLIFAPVFLYFSDWWVARRGMAWGVIGAGNGFGGFVLPWLINAVLEAKGFAWMCR
VWTAFTAVTFAASIILLQPRIPFVKPTDGRAPWLAVDWRFSYNPVFLCMAISTLFASLAY
LPVANYLAVYAASFSSSTTTINLVVGLFNLAACGGCILVGRIADYSLTLGLTLVGLCGLV
LSLTAWGLADTLGKVYAFAVLFGLTGQQAAASAAVTKDLSLNNPSTSTLIVTLLAAIRGA
TSLFIPFVLQALYDSRQAKEVPTFGKYGFLRMIVFVGAASAGLALCGLLMGGLRRKYAIK
SN