Protein Info for mRNA_1236 in Rhodosporidium toruloides IFO0880

Name: 9604
Annotation: K02377 TSTA3, fcl GDP-L-fucose synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01370: Epimerase" amino acids 8 to 242 (235 residues), 165.6 bits, see alignment E=2.2e-52 PF16363: GDP_Man_Dehyd" amino acids 48 to 288 (241 residues), 50.1 bits, see alignment E=4.4e-17

Best Hits

Swiss-Prot: 65% identical to FCL_CRIGR: GDP-L-fucose synthase (TSTA3) from Cricetulus griseus

KEGG orthology group: K02377, GDP-L-fucose synthase [EC: 1.1.1.271] (inferred from 70% identity to scm:SCHCODRAFT_77280)

Predicted SEED Role

"GDP-L-fucose synthetase (EC 1.1.1.271)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 1.1.1.271)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.271

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>mRNA_1236 K02377 TSTA3, fcl GDP-L-fucose synthase (Rhodosporidium toruloides IFO0880)
MSSSKNVILVTGGTGLVGAAIDYVTQHEPVGSRYGKFAEDDQWVFLSSKDGDLRDLAQTM
AIFDKYEPTHVIHLAALVGGLFKNMKYKLTFLRDNLLINDNVLWASKEHGVKKVISCLST
CVFPDKVSYPIDESHVHLGPPHSSNFGYAHGKRLVDVYNHAYNEEFGCNFTAAIPTNIFG
PHDNYDLEDSHVIPGLVHKCYLAKKNNTPFTVSGSGTPLRQFIYSRDLAKLFIWQLKEYP
EIDPIILSVGEEDEITIKQVAESIVKAVGFQGEVTWDSSKADGQYKKTASNSKLRKYLPD
FEFTPFDVALQESVDWFVQNYDKARTGAAAKKQ