Protein Info for mRNA_1269 in Rhodosporidium toruloides IFO0880

Name: 9637
Annotation: K15628 PXA ATP-binding cassette, subfamily D (ALD), peroxisomal long-chain fatty acid import protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 797 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 397 to 416 (20 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 144 to 415 (272 residues), 297.3 bits, see alignment E=1.1e-92 PF00005: ABC_tran" amino acids 561 to 703 (143 residues), 53.2 bits, see alignment E=4.9e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (797 amino acids)

>mRNA_1269 K15628 PXA ATP-binding cassette, subfamily D (ALD), peroxisomal long-chain fatty acid import protein (Rhodosporidium toruloides IFO0880)
MAPAQSKLAQQSALTGLRAKGGAAVFAALVALVYLRRKVVQAAAEAAEKRNRQMLTTPQI
ELAQRDLYNPLPGGARELLVPARGRVSKVLIKPTKATTFARHRPLFRKPPPAPRSASSAA
PPSAGAAAQRVGVNKEFFRQLSAIFRIIIPHATSKEVWLVGAHTAFLLLRTYLSLLVAQL
DGKLVGDLVSANGKGFLRGLCYWFLLAIPSVYTNAMIRFLQSKLSISFRTRLTRYVHDLY
LDKNATFYKVVNLDSRIGASGADQFVTTDINRFCETLSALYSNVSKPTLDLILFNIQLGR
SIGGRGSVGLFLSYLATAWILRKVTPAFGKLAAIEAKLEGDFRAAHARLIINSEEVAFYD
GAPIEKDILTKAYLRLIKHVNSIYKMRILYGMTEDMVVKYLWSAAGYCLISIPVFFPKAR
KLAAAAAGTSAEPKDPAKQKGGDGLSISQRTENYISNRRLLLSLADAGGRLMLSWKDLSE
LAGSTSRVYTLLSTLHDLSTSTYTSLPRPADLAPDAPFYDLGSLNGRFIADAPPEEGVTL
DKVPIVAPAPGVARGGEELVHQLSVRVKPGEHLLITGGNGTGKTAIARVLAGLWPVWDGV
VVRPDDTKIMFLPQRPYLSSGSLRDQIIYPHSYPDFVKSGKTDEDLMEILRKVHLSYLPS
REGGYDVRKEWKDILSGGEKQRMGMARLFYHLPKYGVLDECTSAVSTDVEGSMYQHAKDV
GITLITISHRPSLFKHHMYLLRLTGVEGQWEMTQIGEAEQSLSFQKEIESLQAKLAEVET
WKNRLSTIDAELHFKET