Protein Info for mRNA_1276 in Rhodosporidium toruloides IFO0880

Name: 9644
Annotation: K01070 frmB, ESD, fghA S-formylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02821: S-formylglutathione hydrolase
  • amino acids 6 to 293 (288 residues), 310.7 bits, E=5.2e-97
• PF00756: Esterase
  • amino acids 29 to 288 (260 residues), 146 bits, E=8.3e-47

Best Hits

Swiss-Prot: 48% identical to SFGH_ARATH: S-formylglutathione hydrolase (SFGH) from Arabidopsis thaliana

KEGG orthology group: K01070, S-formylglutathione hydrolase [EC: 3.1.2.12] (inferred from 60% identity to scm:SCHCODRAFT_255629)

Predicted SEED Role

"S-formylglutathione hydrolase (EC 3.1.2.12)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 3.1.2.12)

MetaCyc Pathways

• formaldehyde oxidation II (glutathione-dependent) (3/3 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)

KEGG Metabolic Maps

• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.12

Protein Sequence (300 amino acids)

>mRNA_1276 K01070 frmB, ESD, fghA S-formylglutathione hydrolase (Rhodosporidium toruloides IFO0880)
MPAPEQVAENYSFDGVIRKFKATSTSLGGLETQFNVFVPKEALDGQKVPVLYYLAGLTCT
EDTAPWKGGFLRDAAAEGIALVFPDTSPRGAGIEGEEKDWDFGTAAGFYLNATKDPWSKH
YNMYDFLTSELPSLLSSLSLPLDLSRSSIFGHSMGGHGALTLYLKSLLASSPPTTYLSAS
AFAPIANPIKCQWGEKAFKGYLSGGVEEGKEYDATELIGQVKGKEVKILVDVGTGDIFYK
QKQLLPENFIAARDAAGFSSKDVEVNLHEHYDHSYYFISTFAPAHIRFHAQILKNAAGKL