Protein Info for mRNA_1320 in Rhodosporidium toruloides IFO0880

Name: 9688
Annotation: K00384 trxB thioredoxin reductase (NADPH)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF07992: Pyr_redox_2" amino acids 90 to 388 (299 residues), 177.8 bits, see alignment E=6.1e-56 TIGR01292: thioredoxin-disulfide reductase" amino acids 90 to 400 (311 residues), 385.6 bits, see alignment E=5.7e-120 PF13738: Pyr_redox_3" amino acids 193 to 372 (180 residues), 56.7 bits, see alignment E=5.1e-19 PF00070: Pyr_redox" amino acids 242 to 315 (74 residues), 52.3 bits, see alignment E=1.4e-17

Best Hits

Swiss-Prot: 59% identical to TRXB2_ARATH: Thioredoxin reductase 2 (NTR2) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 75% identity to uma:UM03763.1)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>mRNA_1320 K00384 trxB thioredoxin reductase (NADPH) (Rhodosporidium toruloides IFO0880)
MPSRISKPDPQPGLALLARSLTRTSHSHSCSKLLTHTATTFRSLLNTARARIPTTVAAAA
SASFATASRAMAPIEVNGGAAAEKTSKHNKLVIIGSGPAGHTCAIYAARAQLNPVMFEGM
LANGFAAGGQLTTTTDVENFPGFPEGIRGPEMMDLFRAQSLRFGTTIHTETISRVDLSSR
PFKLWREGMEQEEPETAETLVIATGASARRMHIPGEETYWQSGISACAVCDGAVPIFRRK
PLAVVGGGDSACEEAMYLTKYASHVYMLVRRDVLRASKVMAKRAMSHPKITILWNTIPLE
AKGDGEVLTSLRLKDTKTNEERDLEANGLFYAIGHVPATELVKGQLELDEDGYIVTKPGT
TQTSVPGVFAAGDVQDKVYRQAVTSAGSGCQAALESERWLSEHDLEA