Protein Info for mRNA_1327 in Rhodosporidium toruloides IFO0880

Name: 9695
Annotation: K14684 SLC25A23S solute carrier family 25 (mitochondrial phosphate transporter), member 23/24/25/41

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 762 transmembrane" amino acids 561 to 579 (19 residues), see Phobius details amino acids 615 to 633 (19 residues), see Phobius details amino acids 653 to 676 (24 residues), see Phobius details amino acids 718 to 735 (18 residues), see Phobius details PF13499: EF-hand_7" amino acids 207 to 263 (57 residues), 39.3 bits, see alignment 1.9e-13 PF00153: Mito_carr" amino acids 441 to 545 (105 residues), 64.5 bits, see alignment E=1.8e-21 amino acids 558 to 646 (89 residues), 62.4 bits, see alignment E=7.6e-21 amino acids 654 to 744 (91 residues), 81.8 bits, see alignment E=6.9e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (762 amino acids)

>mRNA_1327 K14684 SLC25A23S solute carrier family 25 (mitochondrial phosphate transporter), member 23/24/25/41 (Rhodosporidium toruloides IFO0880)
MIALERTTPPDEADTPPPPPLPDYPIPPSLNLDPVPSKHELFTVTTSSPFSAPPPADDPR
VSLRHPHSSSNTLNRIDAPPEPCTLSEFRDSEGPARRMTRLRSLFESLPPPSPPSTTSPL
PPTPDEAPQPTEDEATRCAQDRKAYARELWRKCGASVAASVPPSATPSSSTAPPPSPDNE
RQRTAALAAVRWKAFEQYAEEKERELWRAFVELDHDGDMRLRKDEVREACRRAGIEVREG
AIDEFVRTVDRNGDGVISFDEWRDFLLLLPRQTSMKEIWRYWQAKRLERPSMSRLTQDGD
VVIGRGKSGWNRLLGKSTSSSSSSNRTRPEDREAAQRLADATNLRKLEPVNDEQKYVAAC
ERIRDERRNKGKARANAEAVAKAPSSSTSLDFEESGVIVTDKEREEVKPQVEQAQVATVR
EEEEEEEHEPTHDMFAGAGKFLLAGGMAGAVSRTATAPFDRLKVYLITSPASAPPKPDPA
AQLAKSGKPPRPGAGTLVNAIRAVYAQGGGIKAFWTGNGLNIIKIFPESAIKFLSYESAK
RIFAQYWDKVPDQTLISNSSRFVAGGIGGVISQFCIYPIESLKTRVMSSSGGCKKGNALI
SQTARDMWRSGGFRFFFRGLPAGLIGVFPYSAIDMSTFEGIKLAYTKWAGEEPGIAGSLT
FGAISGGVGASSVYPLNLVRTRLQAQGTPAHPQTYTGIRDAAFKCYQREGWRGFYKGLTP
TLVKVVPAVAISYAVYDTSKKMLFAQEEPICHAHDGDSTEES