Protein Info for mRNA_1345 in Rhodosporidium toruloides IFO0880

Name: 9713
Annotation: KOG2533 Permease of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 transmembrane" amino acids 111 to 128 (18 residues), see Phobius details amino acids 172 to 188 (17 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 359 to 382 (24 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details amino acids 424 to 445 (22 residues), see Phobius details amino acids 457 to 477 (21 residues), see Phobius details amino acids 486 to 507 (22 residues), see Phobius details amino acids 519 to 540 (22 residues), see Phobius details PF07690: MFS_1" amino acids 133 to 503 (371 residues), 77.5 bits, see alignment E=5.1e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (597 amino acids)

>mRNA_1345 KOG2533 Permease of the major facilitator superfamily (Rhodosporidium toruloides IFO0880)
MLYCQPRSQFQRGSSLRPLLLAPLPRSLSLLAGTTASQIDHSSDNTGGRQNRSPSRPLLL
RLTPIRTSSTMLPPPDAQHAPPADTPAIVEKSDEEAAAVAAVDEKRLLRKLDFLIMPILL
IIVGLQYYDKAVLNSAAIFGIIPDLHLSTTHIDPTTGKKIVSTLRYSTASSAFYWGFAAA
VLPAALLLKRVNAVKTLGLLVLLWGVVVCLTVVCTSYQGLIVQRVFLGVLESSVSPGFVL
LTTMWYKRSEQATRLGIWYSATGIWSSFSGLVNFGLGSAHGSYPAWKRQYLFAGCLTILA
SSLLLFVLPSSPATPNRFFSEQERAVLVRRTRSNMGGRIGFGGVWDWRQVKEAACDIKIY
IFALMGAGIYICNGAVTAFASQIIKSLGSYSSLQAIALGVPAGIFTAVFIYFFTFLSHKF
PNSLTILLPISCIPVIVGAAIIHGASWKHPGVPLFGNYLLATFGSPYVLLLALAASNVAG
STKKAITSGAIFVGYCVGNIVAPYTVFISEKSVKFRSTWIALYVSLGVVMLLSLLLRFIL
ARENRLRQSTTSSAPTSSDPEKVDDSCASSVVSDEEQERIEREDLTDWENKRFRYTL