Protein Info for mRNA_1367 in Rhodosporidium toruloides IFO0880

Name: 9735
Annotation: K03233 EEF1G elongation factor 1-gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 PF02798: GST_N" amino acids 5 to 76 (72 residues), 42.6 bits, see alignment E=1.9e-14 PF13417: GST_N_3" amino acids 7 to 79 (73 residues), 36.3 bits, see alignment E=1.8e-12 PF00043: GST_C" amino acids 123 to 197 (75 residues), 39.9 bits, see alignment E=1.2e-13 PF13410: GST_C_2" amino acids 127 to 190 (64 residues), 26.9 bits, see alignment E=1.2e-09 PF14497: GST_C_3" amino acids 129 to 194 (66 residues), 22.6 bits, see alignment E=3.1e-08 PF00647: EF1G" amino acids 254 to 360 (107 residues), 131.8 bits, see alignment E=3e-42

Best Hits

KEGG orthology group: K03233, elongation factor 1-gamma (inferred from 47% identity to ssl:SS1G_00220)

Predicted SEED Role

"Translation elongation factor 1 gamma subunit" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>mRNA_1367 K03233 EEF1G elongation factor 1-gamma (Rhodosporidium toruloides IFO0880)
MSFATVYGFEGNPRTRVQHIVAKYEGIQLEHVETNPMAEGGLPADYTAKFPLGLIPALEK
GDFKLTEALAIATYLASQENKAGLLGKGKEDAADILRWSSWANADLLPSIAAWFRPLKGL
VPYQKPQVEAAKAKAMKHLNYLEKTLANRTFLVGERISLGDVFTAAVLFRGFENVLDAEW
RKQNPNTMRYWNTVIHQAPFFEVIKTEPTLIETAIVYTPPKKEAKPKAEQPAAAPKPKAP
AAADEEEDKPAEPKAKHPCEALGPASSFPLDEFKRQYSNNDTPVAMKWLDEHYNANDYSI
VRCDFKYNEELTQTFMSANQCTGFHTRLEASRKFLFGSLNVYGTSGNSKIIGVYMIRGND
WKAVFDVAPDYESYNFTMLDYKTDRELIEKVWSWEGEVEGLTVADGKIFK