Protein Info for mRNA_1397 in Rhodosporidium toruloides IFO0880

Name: 9765
Annotation: K03242 EIF2S3 translation initiation factor 2 subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 PF00009: GTP_EFTU" amino acids 75 to 278 (204 residues), 80.9 bits, see alignment E=1.5e-26 PF03144: GTP_EFTU_D2" amino acids 310 to 392 (83 residues), 40.7 bits, see alignment E=3.8e-14 PF09173: eIF2_C" amino acids 404 to 492 (89 residues), 114.3 bits, see alignment E=3.8e-37

Best Hits

Swiss-Prot: 75% identical to IF2G_SCHPO: Eukaryotic translation initiation factor 2 subunit gamma (tif213) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K03242, translation initiation factor 2 subunit 3 (inferred from 78% identity to mgl:MGL_3841)

Predicted SEED Role

"Eukaryotic translation initiation factor 2 gamma subunit" in subsystem Translation initiation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>mRNA_1397 K03242 EIF2S3 translation initiation factor 2 subunit 3 (Rhodosporidium toruloides IFO0880)
MAAPSPLAQSHRPPRSDIDSDSEDDSPAQGTSQVSNNAVQTVASKLAELALIEEVDVDLE
NLHALSPEVISKQATINIGTIGHVAHGKSQTVKAISGVHTVRFKNELERNITIKLGYANA
KIYQCQNPKCERPGSYRSYSSDKEDEPPCEVPGCGGKMKLLRHVSFVDCPGHDILMATML
NGAAVMDAALLLIAANETCPQPQTSEHLAAIEIMKLKHILVLQNKVDLIREQQADEHYQQ
ITQFVKGTVADGAPIIPISAQLRYNIDALVEYIATKIPVPVRDFTTAPKLIVIRSFDVNK
PGAEVHELKGGVAGGSLLNGVLKLGQEIEVRPGVVSKDAEGKIHCKPIRSKIVSLLAEKN
ELKFAVPGGLIGVGTLIDPQLTRGDRLVGQVLGSKGSLPSIYTEIEISYFLLRRLLGVKS
DDKKQTKVAKLAKNEILMVNIGSTSEGGRVVSVKADLARVILNTPAACSMGEKVALSRRI
EKHWRLIGWGAVRRGVEYQVDDE