Protein Info for mRNA_1403 in Rhodosporidium toruloides IFO0880

Name: 9771
Annotation: K08190 SLC16A14 MFS transporter, MCP family, solute carrier family 16 (monocarboxylic acid transporters), member 14

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 transmembrane" amino acids 147 to 168 (22 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details amino acids 389 to 407 (19 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details amino acids 445 to 470 (26 residues), see Phobius details amino acids 482 to 504 (23 residues), see Phobius details amino acids 511 to 533 (23 residues), see Phobius details PF07690: MFS_1" amino acids 156 to 436 (281 residues), 48.3 bits, see alignment E=3.7e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (546 amino acids)

>mRNA_1403 K08190 SLC16A14 MFS transporter, MCP family, solute carrier family 16 (monocarboxylic acid transporters), member 14 (Rhodosporidium toruloides IFO0880)
MAPLQDSHTRWAEDELTPPVSPAPSAAVSRTPTLVDLHAHGLAAARADGAKGLKDEQEEG
IKTATHDGHHHQHHLPHLHLPPHPNQHLERYYPAEHYEATGEIEREKAEAQRRAAEGGAD
PEKAAEGETAATVTPGVDDYPDGGFKAWLVVAGAWCISFTAWGYPNGFGVLLSYWSRNQL
STYAESDIAWIGSFQIAANLFTAVLSGKAFDAGYCKHLLVAGLFVYTAGLFGLSYASTYW
QIFLAQGLACGLASGLTFLPACSAVSHYFKKRRMLALGFLATGSSLGGVVYPSMMNKLLY
QVGYGWTIRAVGFINLGLIVFACFAISSRLPPRPMGSITSFLDFGVFRGEANRAYRLYVL
GASFVWLGLYTPLFYSEQYALFNGVRSNIAFYSLAMLNATSVFGRTLPNYFADQYGPLNL
LIPATAVSGLMIFFWIPAMMNAAGVIVWSLLFGAFQGAFVAMLPAAIAALTEDMRTVGIR
MAMAFLCQSFAALIGTPICGYVISYNAGRTGFIGAGILSGGEVLAGVVFIAFARFAAAKR
KGTPWV