Protein Info for mRNA_1407 in Rhodosporidium toruloides IFO0880

Name: 9775
Annotation: K02937 RP-L7e, RPL7 large subunit ribosomal protein L7e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF08079: Ribosomal_L30_N" amino acids 8 to 79 (72 residues), 97.4 bits, see alignment E=4.5e-32 TIGR01310: 60S ribosomal protein uL30" amino acids 9 to 243 (235 residues), 326.9 bits, see alignment E=3.7e-102 PF00327: Ribosomal_L30" amino acids 84 to 134 (51 residues), 60.9 bits, see alignment E=8.9e-21

Best Hits

Swiss-Prot: 66% identical to RL7_NEUCR: 60S ribosomal protein L7 (rpl-7) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K02937, large subunit ribosomal protein L7e (inferred from 72% identity to scm:SCHCODRAFT_74697)

Predicted SEED Role

"LSU ribosomal protein L7e (L30p)" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>mRNA_1407 K02937 RP-L7e, RPL7 large subunit ribosomal protein L7e (Rhodosporidium toruloides IFO0880)
MSSQTPLVPETLLKKRKSTEKSREEKRAAALEARKVRKAKRAVIFKRAEQYVNEYNKKER
EEIRLRRQAKANGDFYVPAQPKVYFVMRIKGINNIAPKPRKILQLLRLLQINNGVFVKVT
KATSEMLLRVEPYITYGEPNLKTIRELVYKRGYGKVNRQRVPLSSNAVIEENLGKYGILS
IEDVVHEIATVGPHFREVSNFLWPFKLSNPNGGSRPRKFKQFIEGGELGKREAFINDLVR
KCN