Protein Info for mRNA_1432 in Rhodosporidium toruloides IFO0880

Name: 9800
Annotation: K01653 E2.2.1.6S, ilvH, ilvN acetolactate synthase I/III small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00119: acetolactate synthase, small subunit
  • amino acids 107 to 327 (221 residues), 208.5 bits, E=2.7e-66
• PF01842: ACT
  • amino acids 108 to 172 (65 residues), 46.4 bits, E=4.1e-16
• PF13710: ACT_5
  • amino acids 117 to 173 (57 residues), 28.7 bits, E=1.5e-10
• PF10369: ALS_ss_C
  • amino acids 267 to 326 (60 residues), 61.1 bits, E=1.5e-20

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• superpathway of (R,R)-butanediol biosynthesis (3/5 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• L-isoleucine biosynthesis IV (3/6 steps found)
• superpathway of L-threonine metabolism (11/18 steps found)
• superpathway of 2,3-butanediol biosynthesis (2/6 steps found)
• L-isoleucine biosynthesis II (3/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Protein Sequence (357 amino acids)

>mRNA_1432 K01653 E2.2.1.6S, ilvH, ilvN acetolactate synthase I/III small subunit (Rhodosporidium toruloides IFO0880)
MALAVLRQRAARAVARQSSSTPSATAAPSAARALQTSARAQSTPTKPVNKQPHETTSSTA
AAEYKWTHPRPKPPPLPAIDPQPWSVEQAVQSIIYNCPPPSLQPFTRHTLNCLVQNEPGV
LSRVSGILAARGFNIDSLVVCATEVEDLSRMCIVLRGQDGVIEQARRQLEDLVPVWAVLD
YTRTKTIERELLLAKISILGPEYFGEQLANKGPDILPATEGLEEGSPAKQHADNTVKAAG
SIHPGVDVDYHAPRLSPSEALRQKHQHLAGIELIAKQFGGKLVDVSNDSVIVEMTGKTTR
VDAFLKLVRPYGILEAARSGAMVMPRAPIASPWSGMADEDTTGEQVEAFDASLLPPG