Protein Info for mRNA_1449 in Rhodosporidium toruloides IFO0880

Name: 9817
Annotation: K03325 TC.ACR3 arsenite transporter, ACR3 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 61 to 80 (20 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 191 to 215 (25 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details TIGR00832: arsenical-resistance protein" amino acids 55 to 385 (331 residues), 351.5 bits, see alignment E=2.4e-109 PF01758: SBF" amino acids 100 to 299 (200 residues), 160.3 bits, see alignment E=2.4e-51

Best Hits

KEGG orthology group: K03325, arsenite transporter, ACR3 family (inferred from 58% identity to act:ACLA_028820)

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>mRNA_1449 K03325 TC.ACR3 arsenite transporter, ACR3 family (Rhodosporidium toruloides IFO0880)
MDRTPAAQTAQPLPSQMHTHQPHDEHAAAHPHLDSMVDRAAHPPQHTPPLQLKRLKLLDQ
LLALWILLAMALGIILGALVPSTSVVLEKVQFVGVSLPIAIALIVMMWPILCRVSPGSLI
PLFRQRQLWQHLAFSVVVNWIVSPLLMLGLAWAFLPDKEDLREGLIVVGVARCIAMVLVW
TDIAGGDLDYCAILVAFNSILQMVLFSPVSILFLRVFRTQPLGDWEDKDIDYTTVAKSVA
VFLGIPLAAAVLTRSFFFAIRKQKFFQERFLPAIAPLSLISLLFTTVIIFAAQGKQVVHS
ITDVLRVIPPLIIYFFTTFAAVVFLLRQFHVPYPRTATQAFTASSNNFELAQAVCIATYG
AQSPQALAATVGPLVEVPVLLSLAYLLVHLRRRWRWDTDDECPTTFYCHGKNCTPKSKDS
IEGRAAVKEEQV