Protein Info for mRNA_1461 in Rhodosporidium toruloides IFO0880

Name: 9829
Annotation: K02503 HINT1, hinT, hit histidine triad (HIT) family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 PF04677: CwfJ_C_1" amino acids 8 to 111 (104 residues), 27.1 bits, see alignment E=5.2e-10 PF11969: DcpS_C" amino acids 9 to 112 (104 residues), 45.3 bits, see alignment E=1.8e-15 PF01230: HIT" amino acids 18 to 107 (90 residues), 79.1 bits, see alignment E=5.4e-26

Best Hits

Swiss-Prot: 60% identical to HNT1_YEAST: Hit family protein 1 (HNT1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 75% identity to cci:CC1G_11182)

Predicted SEED Role

"Histidine triad (HIT) nucleotide-binding protein, yeast YDL125C (HNT1) homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (141 amino acids)

>mRNA_1461 K02503 HINT1, hinT, hit histidine triad (HIT) family protein (Rhodosporidium toruloides IFO0880)
MASHNTDANCIFCKIIKGDIPSFKLIETDAVYSFLDIGPLSKGHALVIPKYHAPKLHDVP
DEHLGEILATLKKIAVAQGVENYNILQNNGKIAHQVVDHVHFHMIPKPSDTDKEGLVIGW
PAQQANMDELKKYWEEVKGKL