Protein Info for mRNA_1473 in Rhodosporidium toruloides IFO0880

Name: 9841
Annotation: KOG0254 Predicted transporter (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 268 to 292 (25 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 381 to 404 (24 residues), see Phobius details amino acids 440 to 458 (19 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 20 to 469 (450 residues), 316 bits, see alignment E=2e-98 PF00083: Sugar_tr" amino acids 24 to 473 (450 residues), 322.9 bits, see alignment E=3.6e-100 PF07690: MFS_1" amino acids 38 to 426 (389 residues), 85.8 bits, see alignment E=2.9e-28

Best Hits

Swiss-Prot: 42% identical to HGT1_KLULA: High-affinity glucose transporter (HGT1) from Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)

KEGG orthology group: None (inferred from 43% identity to pno:SNOG_08048)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (532 amino acids)

>mRNA_1473 KOG0254 Predicted transporter (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MAPPPKRSLVTRFTTNNYVAGMLPTLAGFMFGCDLISMSGQVSNPAYLNQFNHPNSNLQG
AITAAMPAGSFGGALINSYLSDKIGRKWCIIISGWVWVLGCIIQAASFNVRTLVAGRVVA
GLAVGLGSAIVTIYQAEITRPAIRGRIVATQQLAITFSELLQYFVSFGCSYIANDASFRM
PWALQAIPGLILGILMFAFPESPRWLMDHGREEQALQILADVHAEGDTENELVQLEYLEI
KRQVEFDRTLAARSYLDLLKPEYFRRTFLACITQMWSQLSGNNVMMYYVVYVFQSAGVTG
RRGGLIASGVQYALHFIATIPAVIWVDKWGRRPTMMIGMFTMGCCLFAVGAIQATLGQPL
HSGSSATTTWTIVGHTSARNAVIVLSYIFVMLFSMTYGPCSWIFPSEIHHMRVRGKAVSA
ATATNWSTPPAFRNIQYKTYFVYGTFCICAAINVFFMFPETKGRTLEEMDDLFAAGHAFS
AWRLSSVPKKTLADVEAEVADSDMRSEGDNKHTMNHIEKSSSDHLEQAGRHV