Protein Info for mRNA_1513 in Rhodosporidium toruloides IFO0880

Name: 9881
Annotation: K13280 SEC11, sipW signal peptidase, endoplasmic reticulum-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details TIGR02228: signal peptidase I" amino acids 26 to 173 (148 residues), 102.7 bits, see alignment E=8.8e-34 PF00717: Peptidase_S24" amino acids 51 to 104 (54 residues), 40.2 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 63% identical to SEC11_LACBS: Signal peptidase complex catalytic subunit SEC11 (SEC11) from Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686)

KEGG orthology group: K13280, signal peptidase, endoplasmic reticulum-type [EC: 3.4.-.-] (inferred from 63% identity to lbc:LACBIDRAFT_184000)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>mRNA_1513 K13280 SEC11, sipW signal peptidase, endoplasmic reticulum-type (Rhodosporidium toruloides IFO0880)
MFKEELATMKRLGVRHVLTQALNFAMVLSTALMMWKGLSIVCNTESPVVVVLSESMEPAI
QRGDLLFLTMPRTAPLKHGDITVYKVPGSPIPIVHRVIETHDEKNSTEQWILTKGDNNRV
DDVGLYNGMKYLRRSHIVGKVQAYVPYVGYGTILMNDYPKLKYALLAVLGGGILLQRE