Protein Info for mRNA_1532 in Rhodosporidium toruloides IFO0880

Name: 9900
Annotation: K00766 trpD anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 PF02885: Glycos_trans_3N" amino acids 44 to 108 (65 residues), 35.7 bits, see alignment E=6.5e-13 TIGR01245: anthranilate phosphoribosyltransferase" amino acids 53 to 381 (329 residues), 318.5 bits, see alignment E=2.9e-99 PF00591: Glycos_transf_3" amino acids 120 to 373 (254 residues), 268.2 bits, see alignment E=8e-84

Best Hits

Swiss-Prot: 40% identical to TRPD_THERP: Anthranilate phosphoribosyltransferase (trpD) from Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 52% identity to mpr:MPER_12928)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>mRNA_1532 K00766 trpD anthranilate phosphoribosyltransferase (Rhodosporidium toruloides IFO0880)
MNPAKAGTAHTDSTVTQMIGESGHAASHSHSSPNSYTPESFAVLLKKLVLHPSTFTLDDT
RSAFNHLAEPYGAHPSQIGAFLSALRLTGKDGEPAIVAECAKVMQQHALPVDVGDYGDGP
ICDIVGTGGDGHNTFNVSTTAAIVAAGAGLRVYKHGNKAATSSSGSADILLSLGCPVTTL
PPSAMNQVAARSPFLFLFAPIYHPSMVRVAPFRKQIGFPTVFNALGPLINPAKPKAVIVG
VHSPYLGPIFAEALKITGVERAWVVCGAEGLDEISPAGDTHLWDLHNGTITERTLHPSAF
GINPTPLSSVAGGTPLENSLTLLKLLDNQLPPTDPIENFVILNAAALLVVAGKAKSEREG
VEMARESIASGGAKKALKAFRKASSEFAKQEADLPTGLIG