Protein Info for mRNA_1542 in Rhodosporidium toruloides IFO0880

Name: 9910
Annotation: K01834 PGAM, gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00300: His_Phos_1
  • amino acids 4 to 194 (191 residues), 131.1 bits, E=2.2e-42
• TIGR01258: phosphoglycerate mutase 1 family
  • amino acids 4 to 121 (118 residues), 155.2 bits, E=9.7e-50
  • amino acids 121 to 205 (85 residues), 97.8 bits, E=3.4e-32

Best Hits

Swiss-Prot: 67% identical to PMGY_SCHPO: Phosphoglycerate mutase (gpm1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 72% identity to uma:UM05339.1)

Predicted SEED Role

"Phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• Bifidobacterium shunt (14/15 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/16 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycerol degradation to butanol (11/16 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (4/9 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1

Protein Sequence (207 amino acids)

>mRNA_1542 K01834 PGAM, gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Rhodosporidium toruloides IFO0880)
MPTLRRHGESEWNKLNLFTGWKNPALTEKGRAEALEGGKNLKAAGYTHFDVAFTSVLQRA
NDTLAIILKEIGQEGLETHKDQALNERDYGELTGLNKDDARKKWGEEQVHIWRRSYDVPP
PGGESLELTLKRVLPYYEKEIAPRVEKGEKVLIAAHGNSLRSIIKHLEGLSGEEIVNTEL
ATGVPIVYKLDKSGKVLSKNILNHESK