Protein Info for mRNA_1561 in Rhodosporidium toruloides IFO0880

Name: 9929
Annotation: K01920 gshB, GSS glutathione synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 PF03917: GSH_synth_ATP" amino acids 13 to 525 (513 residues), 449.8 bits, see alignment E=6.8e-139 TIGR01986: glutathione synthetase" amino acids 19 to 525 (507 residues), 461.6 bits, see alignment E=1.3e-142 PF03199: GSH_synthase" amino acids 211 to 321 (111 residues), 110.4 bits, see alignment E=5.8e-36

Best Hits

KEGG orthology group: K01920, glutathione synthase [EC: 6.3.2.3] (inferred from 47% identity to mgl:MGL_0734)

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>mRNA_1561 K01920 gshB, GSS glutathione synthase (Rhodosporidium toruloides IFO0880)
MTGSAWPPELSKEHEQHVLDHAADWALAHGLVLRPLDASTTSGIHAPYSLFPSPFPRHLF
EEAKRLQPLYNDLYARITADDAFLEQVVGGAVSKVDEFQGRLYDIWKQVKKEGIKQSLAL
GLFRSDYLIHAPDRTSPDQYEIKQVEFNTISSSFGALSTRVGELHRYLLASGAYPSHPSL
TPSALHPNPALSGLASGLAAAHKAYGNDNAAVLMVTQDNERNAFDQRPLEYELIEKHGIR
LLRIPFSQLRTTLSLDPSTHALLYTPSSPLPSLPSPLEISLVYYRTAYSPTDYYTSAEWD
TRLLIERSKAIKCPSVGMQLAGAKKVQEVLGSHPEALERFVKSEKDREELRRTFTELYPM
DDSELGKEALRKAYEESERFVLKPQREGGGNNIYRGDIPPFLDRLAEEDKRRGIDEQKGA
EARGEGVEAQPRGREGYILMSLIEPPKGMEQVLVKAGEDKGRRADVVSELGIYGVVLLRE
NVDDATALPEVLVNETVGHLLRTKGRESDEGGVAVGFSVIDSPMLTE