Protein Info for mRNA_1569 in Rhodosporidium toruloides IFO0880

Name: 9937
Annotation: KOG3114 Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 117 to 141 (25 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details PF04893: Yip1" amino acids 107 to 211 (105 residues), 31.3 bits, see alignment E=8.1e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>mRNA_1569 KOG3114 Uncharacterized conserved protein (Rhodosporidium toruloides IFO0880)
MSRPDTLFDVDDSAAGNLSFQNFGSTTIQPDLPSGRISPNASPHVRANEQLYSAEQRIGG
TIDGATKSGGVLNLDFYSGWFDVDTMTVLTRCYKTLIPKEDYVSEVLAGVPDLYGPFWVP
STLVFSLFLTSSLWSSINAYLNDVEYAYDFTRLGAATSVVYTYCLGLPVVMWAAIKYWAS
ASERSPVEIISLYGYQSTVWILVAWLTLIPIAPLRLFLAFLGTLLSLFFLTRNLYPILSN
APNVSARLLIVVATVLHLIFAVALWWGFMAGGSGAFDGKKLKDVAGEIGTGIGGGIDGDG
MRWKW