Protein Info for mRNA_1572 in Rhodosporidium toruloides IFO0880

Name: 9940
Annotation: K02139 ATPeFF, ATP17 F-type H+-transporting ATPase subunit f

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 92 transmembrane" amino acids 64 to 83 (20 residues), see Phobius details PF10791: F1F0-ATPsyn_F" amino acids 2 to 88 (87 residues), 124.3 bits, see alignment E=1.2e-40

Best Hits

Swiss-Prot: 53% identical to ATPK_YARLI: ATP synthase subunit f, mitochondrial (ATP17) from Yarrowia lipolytica (strain CLIB 122 / E 150)

KEGG orthology group: K02139, F-type H+-transporting ATPase subunit f [EC: 3.6.3.14] (inferred from 58% identity to cnb:CNBC1910)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (92 amino acids)

>mRNA_1572 K02139 ATPeFF, ATP17 F-type H+-transporting ATPase subunit f (Rhodosporidium toruloides IFO0880)
LAALIPPKLASPSAIGAPSSAARMAKVVEFYSALPKGPAPKKRVGASPFARYKARYFDGP
NASAAPFLHVIGGLFLLGYTIDYNMHLKHHKK