Protein Info for mRNA_1582 in Rhodosporidium toruloides IFO0880

Name: 9950
Annotation: K01381 PEP4 saccharopepsin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00026: Asp" amino acids 102 to 411 (310 residues), 368.2 bits, see alignment E=4.2e-114 PF14543: TAXi_N" amino acids 103 to 221 (119 residues), 40 bits, see alignment E=5.3e-14

Best Hits

Swiss-Prot: 59% identical to CARP_ASPFU: Vacuolar protease A (pep2) from Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100)

KEGG orthology group: K01381, saccharopepsin [EC: 3.4.23.25] (inferred from 67% identity to scm:SCHCODRAFT_71897)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>mRNA_1582 K01381 PEP4 saccharopepsin (Rhodosporidium toruloides IFO0880)
MLALTTTALALLAASQGAQAGGTRMKLHKMERTTADDFGVNSVAALADKYLARYSNQLAF
SRGKYPPSRDTDFRIQVEQDQFNDELAKGGHGVPISNFANAQYYHEITIGTPPQTFKVIP
DSGSSNLWVPSVKCSSIACFLHAKYDSSQSSTYKANGSDFAIRYGSGSLEGFISSDTVSV
GDLQIKHQDFAEATSEPGLTFAFGKFDGIMGIAYDTISVNGVVPPFYNMINQGLIDEQVF
SVYLGKDNDDSEIVYGGIDDKHYQGKIEYFPVRRKGYWEIELEAFKLGDETLELENTGAA
IDTGTSLIALPSDIAELLNRELGAKKSWNGAYTVECSTIPSLPKVAFTFGGRDFVLDGSD
YILEAQGTCISPFTGLDIPPPAGPIWIVGDVFLRKFYSVYDLKRNAVGLAKSR