Protein Info for mRNA_1585 in Rhodosporidium toruloides IFO0880

Name: 9953
Annotation: K00916 CTK1 CTD kinase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF00069: Pkinase" amino acids 39 to 323 (285 residues), 238.5 bits, see alignment E=8.7e-75 PF07714: Pkinase_Tyr" amino acids 44 to 234 (191 residues), 115.9 bits, see alignment E=2.1e-37

Best Hits

KEGG orthology group: K08819, Cdc2-related kinase, arginine/serine-rich [EC: 2.7.11.22] (inferred from 60% identity to scm:SCHCODRAFT_46333)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.22

Use Curated BLAST to search for 2.7.11.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>mRNA_1585 K00916 CTK1 CTD kinase subunit alpha (Rhodosporidium toruloides IFO0880)
MDSQSLPPPTPSNPPTPVPTVPAIAAAAAPPPPPPTELYERLVQVGEGTYGKVYKARNVE
SGGLVALKRIRMEAEKDGFPVTAVREIKLLQTLRHPNVVELVEMLVSKGQVYMVLEYLDH
DLTGVLHHPSINFSPAHLKSLMQQFLQGLGFIHRRGVLHRDLKGSNILLSKCGELKIADF
GLARFYQRGRNNDYTNRVITQWYKPPELLFGATVYDERVDMWSAGCIFLELFARRPIFPG
QDEIHQLDVIFKLTGTPNLDNWPGLQDLPWYELVKPKEVIEPCLRQEFAKYLTPAGLDVA
EALLALDPARRPTADEALRMPYFVSEEPQAEMPTMLADVEGEWHEYESKRQRRRQRGDDG
A