Protein Info for mRNA_1604 in Rhodosporidium toruloides IFO0880

Name: 9972
Annotation: K02209 MCM5, CDC46 DNA replication licensing factor MCM5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 742 PF14551: MCM_N" amino acids 42 to 135 (94 residues), 57.1 bits, see alignment E=7.4e-19 PF17207: MCM_OB" amino acids 147 to 283 (137 residues), 116.8 bits, see alignment E=1.7e-37 PF00493: MCM" amino acids 326 to 548 (223 residues), 350.8 bits, see alignment E=7.2e-109 PF07728: AAA_5" amino acids 383 to 499 (117 residues), 24 bits, see alignment E=1e-08 PF17855: MCM_lid" amino acids 564 to 654 (91 residues), 93.7 bits, see alignment E=2.3e-30

Best Hits

Swiss-Prot: 52% identical to MCM5A_XENLA: DNA replication licensing factor mcm5-A (mcm5-a) from Xenopus laevis

KEGG orthology group: K02209, minichromosome maintenance protein 5 (cell division control protein 46) (inferred from 65% identity to uma:UM05064.1)

Predicted SEED Role

"DNA replication helicase protein MCM" in subsystem DNA replication, archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (742 amino acids)

>mRNA_1604 K02209 MCM5, CDC46 DNA replication licensing factor MCM5 (Rhodosporidium toruloides IFO0880)
MNAGFDRESVYSVPVYGSDFSGRTGASDATTTAQQNTQTIADFQQFVTEFRENESFVYRD
RLRANCLRKEWTLEVEMGHLIGWREDLASRCRNEPGEMVPLFEIALRNVARNLLFPTAAG
AEERQERQKAVPEIQLQLRSGSRLMQFRELGATNISRLVRLPGIVISASVLSSRAIRLHL
TCKSCRHVTTMDVQGGFSGFQLPRKCIAPAPPGETKDCPLDPYVIVHDKCTFVDQQTIKL
QEAPDMVPVGELPRHLILSADRYLTGKVVPGSRVIATGIYSTFQSGKSRRDTPVALRTPY
LRILGLEVDREGAGGQGVRNFTAEEEEEFEKLGKQPDIYEKFARSIAPSIFGNADIKKAI
ACLLFGGSKKVLPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAG
LTASVQRDPQSREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAG
ITTILNSRTSVLAAANPVFGRYDDMKTPADNIDFATTILSRFDMIFLVKDEHNEARDATI
AKHVMNIHMNRATEQGVVGEIDIETMKRYVSYCKARRAPRLSSDAAQKLSSHFVALRKQV
QQLERDNNERSSIPITVRQLEAIIRISESLAKIELKTEVLDSHVDEAIRLFKFSTMDAVR
AGNVDGLSKSELMEEVNAIEDELRKKNRLGVGRTLPYSSLRDYFTRNRGFTQHAFDRCLM
ILERSDVLQFLQQRRLVRRIAI